#veganporn

101,151 posts

Loading...
Lunch with a friend at a local vegan cafe-lentil soup, cauliflower ”wings”, spring rolls, and vegan Mac’nCheese 🌱👍 #vegan #veganporn #veganfoodshare #veganfood #govegan #whatveganseat #vegansofinstagram #vegansofig #plantbased #crueltyfree . . . . . בוקר טוב 😘
We are so spoilt for quality products here in Perth. At the moment I’m loving this cultured vegan butter at the moment from #botanicalcusine
Clearly an autocorrect fail at Love chock #lovechock #Veganfood #Veganporn #Glutenfree #Insportionalquotes
An acquired taste: Stuffed bitter melon soup (Canh Kho Qua Chay). This prep is a classic Vietnamese favorite. It’s heartiness lies within the contrast of savory sautéed vegan meat, ginger, and melon bitterness. Not only is this dish tasty, it’s also so good for your immunity. Bitter melon has many positive benefits such as anti-inflammation, anti fungus , antibiotic, anti-allergenic, antiviral, and anti-parasitic medicinal qualities. I made this for myself this morning to fight off my current cold and it’s bringing back many childhood memories. Strangely when I was child, I couldn’t stand the bitterness of this dish and would go straight for the savory inside....But as my taste buds mature, it’s just so delicious 🤤 #ahimsa #veganporn #vegan #vegetarian #plantbased #bestofvegan #letscookvegan #plantpower #whatveganseat #cleaneating #peacefood #canhkhoquachay #glutenfree #bittermelonsoup #foodasmedicine
Jantar sem glamour mas delicioso e acessível 😋💚 Mesmo depois de almoçar tanto e fazer lanches leves tava morrendo de fome. Vocês também têm muitaaaaa fome? #tenhacompaixao #sejavegano #vegan #govegan #vegano #veganismo #veganporn #whatveganseat #veganfood #veganfoodshare #saudavel #saude #healthyfood #comidasaudavel #comidafit #comida #health #healthy
🍓🥕Photo credits : @thefitfabfoodie 🥗 . . . Falafel lunches 😋 baked falafel, quinoa tabbouleh, beet hummus, baba ganoush, muhamara and homemade flatbread - I would love to bring this platter to @raw_manda 💛 my thoughts are with Las Vegas today, so horrible and sad 💔 sending love and hugs to all of you 💋 . . 🍊 Double Tap 😊😊 Comment Below
starting Monday right 👊 oil pulling ✔ acv drink ✔ superfood green smoothie ✔ my all time favourite green smoothie! coconut water, frozen banana, frozen mango, zucchini, spinach, fresh ginger, chia seeds, hemp seeds, super greens powder, maca powder, LOTS of ice 👅👅 . . . . . . . . . #rachaelstable #fresh #superfoods #greensmoothie #mondaymorning #hempseeds #veganporn #vegan #breakfast #foodporn #instafood #nourish #healthy #delicious #mumlife #raisingboys #foodforthesoul #goodforyou #happiness #love #hippie #peace #fruit #greens #dailygreens #vegetables
Pallott cave e ove vegane #ottimo #foodporn #veganporn #veganfood
Vegan/Gluten free Focaccia, recipe on the blog, link in bio 😄 This Focaccia has been topped with pistachios, tomatoes, caramelised onions and chipotle sauce, it was just delicious 😋 i know, i know it looks like a pizza 😅 >SUSCRIBE < >Tag me if you're making this recipe with the #thewitchylifefr < #forkyeah #veganuary #forksoverknives #vegan #veganporn #focaccia #glutenfree #glutenfreevegan #inmykitchen #onthetable #instagood #whatveganseat #veganvultures #friendsnotfood #beautifuleats #f52grams #huffposttaste #buzzfeast #goodmoodfood #easyrecipe #foodiegram #foodblog #plantbasedfood #foodaroundtheworld #healthycooking #homemade #createscenery #food_estetique #scrumptiouskitchen
Qui a dit que manger végétal et bio était cher? Manger des produits prêts à consommer est cher, oui Cuisiner, non #homemadefood #whatveganseat #veganeats #vegansofig #organicfood #localfood #locavore #eatwithseasons #nourritureholistique #mangerdesaison #faitmaison #cequemangentlesveganes #bonappetit #yummy #veganporn #soya #tofu #okara
Bolitas de patata con ajos tiernos dentro y un poquito de queso cheddar vegano 🌱 Ingredientes: -Patata -Ajos tiernos -Sal -Queso Cheddar Modo de preparación: 1. Hervimos la patata y una vez hervida, la "chafamos" con un tenedor hasta que no queden grumos. Le añadimos sal y la dejamos enfriar. 2. Por otro lado, cortamos los ajos y los pasamos por la sartén con un poco de aceite, hasta que queden al gusto (crudos están muy ricos). 3. Una vez hechos y fría la patata, hacemos bolas con ésta y le metemos los ajos dentro. 4. Finalmente, ponemos queso sobre las bolitas y las metemos en el horno durante 15-20 minutos entre 90 y 130 grados. 🌷¡BUEN PROVECHO!🌷 #govegan #vegan #crueltyfree #vegano #loveanimals #veganfoodie #veganporn #food #foodporn #lovefood #animalist #igualdadanimal #cooking #eat #instafood #savetheanimals #cheese #potato
Assiette du soir : Tofu brouillé assaisonné avec du curcuma, du paprika et du basilic, accompagné de patates douces sautées 😊 Simple, mais tellement bon ! Les patates douces c'est la vie 😍😍😍 Bon appétit ! #tofu #tofubrouillé #scrambledtofu #patatedouce #vegan #vegansofig #veganfoodporn #veganporn #foodporn #parisvegan #plantsbased #whatveganseat #végétalien #végétalisme
Risotto, himmlisch 😍 anstelle von Parmesan und Butter einfach durch hefeflocken ersetzten 😊 yummi 😁 #vegan #veganfood #vegandeutschland #veganporn #foodporn #risotto #veganrisotto #veganisiert #isshappy #isshappyveganwerdenleichtgemacht #30tagechallenge
#spicy #walnut #tofu with some #cabbage makes for good #veganporn
~Soupe à la courge, curry & coco // miniburger de champignons de paris avec haricots rouges, nouilles de riz, oignons frais, sauce soya & Hoisin ~ #veganmeal #veganporn #mushroom #vegandinner #yummy #pumpkinsoup #Mushroomburger #vegan
Dinner idea! 😍🌱👌Via @hannah__chia - spicy red lentil curry | jasmine rice, steamed broccoli, cilantro . . been loving red lentils lately— they only take 20 min to cook and they’re softer/mushier than the brown or green varieties, which isn’t ideal for some things but perfect for thick curries like this. i don’t really have an exact recipe because I kind of just eyeballed everything this time, but the ingredients I used are carrots onion garlic ginger thai red curry paste tomato paste dry red lentils veggie broth coconut sugar turmeric cumin paprika salt (sauté onions/garlic/carrots until they’re softened and then add the other ingredients and simmer until lentils are done! v simple) - - - - #veganpowerofficial #plantbasedpower #plantbasedfoods #plantbasedliving #plantbasedeating #veganporn #veganchef #plantbasedgains #plantbasedmeal #plantbasediet #plantbasedfoodie #veganseat #crueltyfreeliving #crueltyfreelife #crueltyfreelifestyle #crueltyfreeblogger #veganfoodlover #veganfoodpics #veganfoodblog #veganfoodies #veganfoodideas #veganfoodshares #veganblogger #veganstyle #vegansnacks #plantbasednutrition #veganblog
Halva. It’s what’s for breakfast. This stuff is @hebelandco made in LA, fresh, crumbly disappears like cotton candy on your tongue. #veganporn #halva #artisanfood @la_foodfeed @lafoodfest #middleeasternfood #dessertsgram
Una rica tortita vegana de selva negra para celebrar el cumpleaños de mi persona favorita en todo el mundo❤️ Feliz cumpleaños mi Nenito 😊@arielenelsantuario ... #dulceelizabetha #veganfood #veganporn #veganshare #vegancake
Sweet Potato Tofu Scramble, roasted Potatoes, Salsa, Guac and Noochhhh ❤️🌿👌🏻#vegan #vegansofig #veganfood #veganheaven #veganporn #plants #plantbased #plantpowered #thelavegan #tofuscramble #salsa #guacamole #guac #avocadolover
Organic Tofu sausages, banging mash, gravy and greens. 🌱 Bliss ✨ loved this more than the mock chicken, tbh it was a close call. I would get both again (for myself) #vegan #mildreds #veganism #veganfood #veganfoodeats #veganfoodporn #veganporn #veganfoodshare #veganfoodlovers #veganfoodlover #vegancommunity #veganshare #food #foodie #foodstagram #foodblogger #foodlover #foodaholic #junkfood #veganuary #vegansauages #tofu #mildreds
Why you should ditch dairy🖕 . Tag someone who needs to see this 🙏 . What are you thoughts? Comment below. . The milk myth has spread around the world based on the flawed belief that this protein and calcium-rich drink is essential to support good overall health and bone health in particular at any age. It is easy to understand that the confusion about milk’s imaginary benefits stems from the fact that it contains calcium – around 300 mg per cup. But many scientific studies have shown an assortment of detrimental health effects directly linked to milk consumption. And the most surprising link is that not only do we barely absorb the calcium in cow’s milk (especially if pasteurized), but to make matters worse, it actually increases calcium loss from the bones. While calcium from animal milk is not absorbed as well as that from plant-based sources, it can be accompanied by a number of dangerous health problems. Take a look at 12 reasons why you should give up dairy above🖕 #environment #vegan #veganlife #vegetarian #veganfoodshare #veggie #vegansofig #veganism #vegansofinstagram #healthyfood #whatveganseat #veganpeople #crueltyfree #vegansnacks #veg #easyveg #foodshare #nutrition #foodie #vegansrock #веган #plantbased #govegan #veganporn #blackmentalhealth #blackhealth #blackvegan #ital #alkaline #healthylifestyle
El gustazo de las pequeñas cosas; como descansar un domingo, pasar la tarde en el sofá tapado con la manta y en buena compañía, o merendar un té matcha calentito y unas galletas con nueces. Ahí, señoras y señores, reside la calidad de vida 🙇🏻‍♂️🍵🍪 @fitgreenmatcha @the_cookies_company
Caramel Chocolate Banana Layered Breakfast 🍌🍫 by @jennacawthray 🌞
🍨 NICECREAM 🍨 • ⬆️ das hier, gibt es bei uns auch gerne mal zum Frühstück 😂 Das Beste an diesem Eis - Es ist gesund und man kann es den ganzen Tag essen ohne schlechtes Gewissen zu haben 😊 • Rezept: 🔸️3 gefrorene Bananen 🔸️anderes Obst nach Belieben oder Kakao 🔸️einen Schluck Hafer,- oder andere Alternativmilch • Man benötigt dazu einen Hochleistungsmixer, vielleicht funktioniert es aber auch mit einem Stabmixer #probierengehtüberstudieren#vegan #nicecream #nanaeis #veganeseis #eatclean #foodporn #essenistliebe #eisessen #eisliebe #icecream #icelove #iceisnice #healthy #healthyice #eatplants #plantbased #diy #food #foodporn #foodpost #foodlove #veganporn #veganfood #veganwerdenwaslosdigger #pregnantappetite #schwangerschaftsgelüste #gesund #gesundessen #schlemmen
Aged Nut Cheese. Ask for it by name. 👴🏼🥜🧀 🥜 🧀 👴🏼 🥜 🧀 #nut #cheese #nutcheese #vegan #veganporn #food #foodie #chef #cheflife #brooklyn #nyc #ny #newyork -#newyorkcity #aged
🍌🌎Via : @nourishnotpunish 🥗 . . . Apricot & walnut loaf😛 Perfect for brekky, snack time or dessert👏🏻 As always, this baby is vegan + gluten free and super yum ~ Recipe below! I’m sorry I’ve been MIA lately, life is hectic right now. I miss you all! I’ll definitely be posting more creations in the coming weeks, much love, Ev❤️ 💘Ingredients: 4 fresh apricots, chopped 1 flax 'egg' (1tbsp flax meal mixed with 3tbsp water) 3/4 cup coconut sugar 1/4 cup melted vegan butter 3/4 cup almond milk 1 + 1/2 cups gluten free self raising flour (or regular SR flour. If using plain flour, add 2tsp baking powder) 1/2 cup crushed walnuts Cinnamon sugar, optional All dry ingredients from my local @thesourcebulkfoods ~ @thesourcebrunswick ✌🏻️ ♻️ Method: 1. Preheat the oven to 180C and grease a small loaf tin. 2. In a bowl, combine the coconut sugar, melted vegan butter and almond milk. 3. Next, add in the flour. 4. Mix the flax 'egg' in the mixture, followed by throwing in the apricots (leave a handful behind to garnish the top of the loaf with) and the walnuts. 5. Pop the mixture into the prepared loaf tin, garnishing with the left of apricot pieces and cinnamon sugar if desired! 6. Put into the oven and bake for one hour and ten minutes. 7. Allow the loaf to cool before removing from the tin! Enjoy😘 Snapchat: Nourishntpunish💩 . . 🥕 DOUBLE TAP 😗😗 Tell us below ⬇
Sevillan@s: cocinamos un buddha bowl diferente cada almuerzo. Si tienes hambre, quieres comer sano, probar un plato original y no te apetece cocinar, te esperamos en casa. A partir de ahora los almuerzos, los vamos a publicar en el perfil de @comoencasa.andalucia ¡Síganos! . . . . #lunch #ok_sevilla #total_sevilla #igerssevilla #thisisseville #unlimitedsevilla #buddhabowl #healthy #instagood #gastrophotos #foodiessevilla #healthyfood #veggie #vegan #foodporn #eaaaats #foodies #foodgram #foodphoto #foodphotograph #foodpict #sevilla #seville #veganporn #veggiefood #followfood #gastronomia #gastrophotos
next page →